DPCfam | MC200515
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Residues in low-complexity regions (%) | 0.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14533 |
| Sequences matching dominant architecture (%) | 96.83 |
| Average overlap percent | 51.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B0AYL0 | 2126-2237 | 112 | FRIEEVPMEDIQLAENEMLIPVAHYSKEIFNLFGVPFLIKAKLNEPYGALKQRIQKRLNVPDKEWENYKFVIMGSNTSDVHDNTP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QUS9-F1 | 980-1109 | 100.00 | 82.51 | View in AlphaFoldDB ↗ |