DPCfam | MC20037
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.97 |
| Average transmembrane regions | 2.44 |
| Dominant Pfam architecture(s) | PF12159 |
| Sequences matching dominant architecture (%) | 96.55 |
| Average overlap percent | 91.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R1DUT6 | 2-85 | 84 | LFGASLFPWLAMLYWLKHPTVGAPPGVTFGLTFLLAFVFGSIPAAIGAGALFGVSLADADWLHGSAESLLAITNCVVVFGFRDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8S9I8-F1 | 80-174 | 98.96 | 84.18 | View in AlphaFoldDB ↗ |