DPCfam | MC200151
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 248 ± 62 aa |
| Residues in low-complexity regions (%) | 14.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15304 |
| Sequences matching dominant architecture (%) | 54.35 |
| Average overlap percent | 61.05 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A1CFE8E | 1-181 | 181 | MQRFMASHGKVGNISNSNTLKMNTRTALTFLENGNSPTSINTGYVPVEHKIQQELQDPRSPEKDLKRLRKIKRQITLKASLEKLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VYM2-F1 | 11-459 | 100.00 | 56.68 | View in AlphaFoldDB ↗ |