DPCfam | MC200061
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.85 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14528 |
| Sequences matching dominant architecture (%) | 73.33 |
| Average overlap percent | 77.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F6HEK0 | 238-327 | 90 | IACLRGLMDTDGGVFIHRYSVNGKNYMYKKISFSNRSVPLLHFVFNTLTELGFTPKIIDKVENKKVWLYNETEVKRYLSQVGSNN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58817-F1 | 273-356 | 100.00 | 87.78 | View in AlphaFoldDB ↗ |