DPCfam | MC199906
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 199 ± 37 aa |
| Residues in low-complexity regions (%) | 3.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10462 |
| Sequences matching dominant architecture (%) | 73.33 |
| Average overlap percent | 48.4 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006943DD4 | 375-537 | 163 | VTAHTSVGNYANGRVVHGLSGGGSIVTLYDCWGNEFSHELGHNFGLSHEPGGFEGSVHRPADTINSTWGWDSDLNVFLPNFEKEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O82882-F1 | 371-583 | 96.80 | 97.26 | View in AlphaFoldDB ↗ |