DPCfam | MC199566
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Residues in low-complexity regions (%) | 24.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.39 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF07684 |
| Sequences matching dominant architecture (%) | 89.66 |
| Average overlap percent | 51.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9KDQ2 | 60-164 | 105 | GSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPASPSPRGAGGGEPLELPEPSVPLLPLLAASAVFLLVILVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P46531-F1 | 1673-1773 | 100.00 | 61.35 | View in AlphaFoldDB ↗ |