DPCfam | MC199466
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Residues in low-complexity regions (%) | 11.48 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 9.85 |
| Average transmembrane regions | 1.09 |
| Dominant Pfam architecture(s) | PF16080 |
| Sequences matching dominant architecture (%) | 48.65 |
| Average overlap percent | 85.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008A3B0FD | 11-77 | 67 | ASGASNWASNATYGGAGVGIMGAFNGVDWVAIIGLAVAIGGFFVNLYFKAKENRRAEEIHEMRKQQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32GL7-F1 | 4-69 | 83.82 | 88.69 | View in AlphaFoldDB ↗ |