DPCfam | MC19926
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1011 |
|---|---|
| Mean domain length (aa) | 296 ± 24 aa |
| Residues in low-complexity regions (%) | 2.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.62 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09924 |
| Sequences matching dominant architecture (%) | 98.1 |
| Average overlap percent | 94.16 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X5LF35 | 149-455 | 307 | RAVASLVNDTRGDPLAPFAMAAGKSYVFSTDGRAALAYRTVGGFAVASGDPIGDQARYPEVVVAFAALCRKQGWRILVLGASARS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0H3X7-F1 | 541-836 | 98.63 | 88.15 | View in AlphaFoldDB ↗ |