DPCfam | MC199143
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Residues in low-complexity regions (%) | 6.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.86 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF00535 |
| Sequences matching dominant architecture (%) | 20.41 |
| Average overlap percent | 8.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P33700 | 145-327 | 183 | IDLVGFVEGNISRRGVRRGEIGFLKPLMRRAFLDQHGLRYNETLRLGEDYDLYARALANGARYKIIHSCGYAAVVRGNSLSGSHR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P33700-F1 | 145-309 | 99.39 | 89.94 | View in AlphaFoldDB ↗ |