DPCfam | MC199134
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Residues in low-complexity regions (%) | 1.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10996 |
| Sequences matching dominant architecture (%) | 32.08 |
| Average overlap percent | 27.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183BQ39 | 401-461 | 61 | GEIVQLLDLWGGMSRNAIIMIDPDYPLETYYAPYKSLAIRAYYYPIETRLDGTQVLNKLLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q08BB6-F1 | 382-472 | 98.91 | 96.56 | View in AlphaFoldDB ↗ |