DPCfam | MC199011
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Residues in low-complexity regions (%) | 9.88 |
| Residues in coiled-coil regions (%) | 43.1 |
| Predicted disordered residues (%) | 40.08 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03245 |
| Sequences matching dominant architecture (%) | 91.9 |
| Average overlap percent | 87.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1P9XYR8 | 21-157 | 137 | TAHARDNATNAQKLQAVSDAAVSAARAAIAKQNDAAAQLTALDSQLQQEKASHEADNAKNRAAIADGTRRLRVAVTAYAPSGGGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P75719-F1 | 18-152 | 97.84 | 92.90 | View in AlphaFoldDB ↗ |