DPCfam | MC199
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 388 ± 32 aa |
| Residues in low-complexity regions (%) | 6.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 60.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9XIH4 | 606-991 | 386 | TPSYDLRCTADRRQRQAAAQLENLQASTWLSEASASPQTYEVELEMQASGLPKLRIKKIDPSPLSEAEPLQREESFLGEESSLRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3IUT5-F1 | 1577-1985 | 99.02 | 37.37 | View in AlphaFoldDB ↗ |