DPCfam | MC198925
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 189 ± 22 aa |
| Residues in low-complexity regions (%) | 6.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.54 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF11339 |
| Sequences matching dominant architecture (%) | 84.78 |
| Average overlap percent | 13.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C0QHM8 | 511-732 | 222 | FSDNNPWMLPFKRLAPIIKENRRKVTPDNPFSDLETSSAKAVGDLLHTYSDLRDDAQELCFRTIYGNRLVQDSFKYRMDEITEQE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9X447-F1 | 508-708 | 98.00 | 88.84 | View in AlphaFoldDB ↗ |