DPCfam | MC19885
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 115 ± 8 aa |
| Residues in low-complexity regions (%) | 4.48 |
| Residues in coiled-coil regions (%) | 1.95 |
| Predicted disordered residues (%) | 8.64 |
| Average transmembrane regions | 0.82 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2WLD8 | 465-572 | 108 | IYQHHLLSAAAIEADLARAKVAVELAQDTVQVLVHLNATSDIYSRQQTAFNYFLLSAFAVISLAICHAPSTFAAGCAQSFIDAVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H0V1-F1 | 524-639 | 99.15 | 80.01 | View in AlphaFoldDB ↗ |