DPCfam | MC198829
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Residues in low-complexity regions (%) | 2.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07367 |
| Sequences matching dominant architecture (%) | 97.96 |
| Average overlap percent | 90.91 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C9XNI4 | 1-132 | 132 | MSYTVEISVFYRESAPEFFSIVEKGIWHYANGGTWTEAAGKQILTMGGSVTSGGLRFKSASGGDAFFIVVGIHNYSLWLDVLPNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F2Z266-F1 | 1-129 | 100.00 | 98.47 | View in AlphaFoldDB ↗ |