DPCfam | MC198623
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Residues in low-complexity regions (%) | 2.66 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 29.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15251 |
| Sequences matching dominant architecture (%) | 98.18 |
| Average overlap percent | 65.32 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003F0EA9C | 161-264 | 104 | EATGFRHQQQRLWHLFQLSATAVAQLYKEAGCQQPGLSLWDPFQNAAVAVTSLYKESGSAHQRSFELGIQLGCQRRRQDVLEWAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q28HY5-F1 | 24-145 | 99.21 | 87.74 | View in AlphaFoldDB ↗ |