DPCfam | MC198535
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Residues in low-complexity regions (%) | 3.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13901 |
| Sequences matching dominant architecture (%) | 91.67 |
| Average overlap percent | 6.04 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0X9E6 | 194-306 | 113 | SDNAALSLLCRFSHRPSCQTDDANWTVSSEDSSELLLSLTAQSTNTTEREEYGKKDWTPIKSHVILQIYTQPKKNLLVNQQRSRC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q663-F1 | 594-720 | 99.21 | 71.51 | View in AlphaFoldDB ↗ |