DPCfam | MC198010
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 175 ± 23 aa |
| Residues in low-complexity regions (%) | 1.43 |
| Residues in coiled-coil regions (%) | 1.0 |
| Predicted disordered residues (%) | 17.11 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF11553- PF11553 |
| Sequences matching dominant architecture (%) | 54.68 |
| Average overlap percent | 59.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A8FAE7 | 134-326 | 193 | VYDNITEVLLNRGTLVRPPHISVPKEVEIVKDPKYISGFPFSQEKRPLNAMEIGHLCYGIETNTAGMQLMTGYAQAARNKAAKNH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06998-F1 | 9-162 | 98.03 | 97.41 | View in AlphaFoldDB ↗ |