DPCfam | MC197876
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Residues in low-complexity regions (%) | 5.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.37 |
| Average transmembrane regions | 1.15 |
| Dominant Pfam architecture(s) | PF10412 |
| Sequences matching dominant architecture (%) | 8.2 |
| Average overlap percent | 11.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5B4G0 | 9-145 | 137 | TRGLRDHDELSDENLVRDTRGIVSRTIDFLGTPQNMTVALASLAVGAFVFYGVGILLLIVALLLTWYAMTRREEGALKLPIQSQM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZMS2-F1 | 324-459 | 83.80 | 75.26 | View in AlphaFoldDB ↗ |