DPCfam | MC197866
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Residues in low-complexity regions (%) | 3.79 |
| Residues in coiled-coil regions (%) | 0.35 |
| Predicted disordered residues (%) | 0.86 |
| Average transmembrane regions | 0.88 |
| Dominant Pfam architecture(s) | PF07099 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 33.35 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L7W5S4 | 150-215 | 66 | ILCACGVYLGRHLRWNSWDLLHSPNKIFLDLFYLFKDVHKNQNAWIMVVSLSTFLIVIYALFKSFF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G0A4-F1 | 141-194 | 90.77 | 87.68 | View in AlphaFoldDB ↗ |