DPCfam | MC197618
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Residues in low-complexity regions (%) | 0.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00100 |
| Sequences matching dominant architecture (%) | 96.55 |
| Average overlap percent | 36.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7U5I4 | 338-408 | 71 | DSLIYTCTLAYVPKGLDLTPIVRSHGAPINIECHYLRRINMSSNAVMPTWVPYSAEEHLVFSLQLMTDNWE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P79762-F1 | 120-198 | 97.53 | 79.13 | View in AlphaFoldDB ↗ |