DPCfam | MC197595
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 623 ± 137 aa |
| Residues in low-complexity regions (%) | 6.9 |
| Residues in coiled-coil regions (%) | 1.56 |
| Predicted disordered residues (%) | 30.54 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF01841 |
| Sequences matching dominant architecture (%) | 5.04 |
| Average overlap percent | 8.14 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146VH41 | 75-581 | 507 | KFVSTTLRPTHPGLCELHSWKDCSSFVADFLALQPLEPPTEVPSQLFSPTSVLRSQKATCFESSTLLCSLLLSLDYDAYCISGYA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G2HE57-F1 | 150-844 | 100.00 | 84.16 | View in AlphaFoldDB ↗ |