DPCfam | MC197336
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 323 ± 33 aa |
| Residues in low-complexity regions (%) | 4.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.34 |
| Average transmembrane regions | 1.59 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J2PBS1 | 5-330 | 326 | ARIEQELDSFPETLTLYREQLKRWFNQKADQASRAADLPSLMGMERLIKLGSTTTAVSSGDDEFLSSVAQCPDGGILEIESKFES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14U76-F1 | 739-781 | 15.81 | 94.72 | View in AlphaFoldDB ↗ |