DPCfam | MC197235
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 340 ± 22 aa |
| Residues in low-complexity regions (%) | 4.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17210 |
| Sequences matching dominant architecture (%) | 50.72 |
| Average overlap percent | 23.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037B75E2 | 179-510 | 332 | TCLGLGGTVFKDFNADGIHQDGEATGLPDITVRAITRVGTTYTTSTDSIGNYTMAIPQAEYPVRIEFTNIPTYAGNGTPNGADGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6GBS5-F1 | 1020-1115 | 31.94 | 88.21 | View in AlphaFoldDB ↗ |