DPCfam | MC197086
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1991 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Residues in low-complexity regions (%) | 4.53 |
| Residues in coiled-coil regions (%) | 22.0 |
| Predicted disordered residues (%) | 22.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01817 |
| Sequences matching dominant architecture (%) | 97.98 |
| Average overlap percent | 89.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B6FU33 | 2-86 | 85 | LDDIRKKIDEIDNSMKPLFLERLACSRQVAEAKAKTKEEVYVPKRETEIIADRSEDTQGETQEAYTAFLKDVMQISRRYQYGVLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O67085-F1 | 4-89 | 98.77 | 93.29 | View in AlphaFoldDB ↗ |