DPCfam | MC196946
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.47 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01094 |
| Sequences matching dominant architecture (%) | 96.36 |
| Average overlap percent | 29.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5KUP0 | 191-275 | 85 | ENDVRIVIGQFDEFSAAKVFCCVYQLGMFGHKYQWILSGWSQTSWWTHTGTSNCSAQSILNAMEGTVSVDFETLSSRHTRGVSGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6PUN0-F1 | 222-312 | 95.56 | 92.22 | View in AlphaFoldDB ↗ |