DPCfam | MC196735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Residues in low-complexity regions (%) | 1.47 |
| Residues in coiled-coil regions (%) | 1.48 |
| Predicted disordered residues (%) | 10.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06920 |
| Sequences matching dominant architecture (%) | 98.15 |
| Average overlap percent | 24.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5BM43 | 695-810 | 116 | VETLQQAERYELLATIFAMITPYYEKRRDYESLVNVYDTMKRGYEKVLEVNRNGKRLLGKFFRVALYGQSHFEEEDGKQYIYKEP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1Q8Z1-F1 | 1776-1883 | 99.10 | 89.40 | View in AlphaFoldDB ↗ |