DPCfam | MC196571
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Residues in low-complexity regions (%) | 8.15 |
| Residues in coiled-coil regions (%) | 0.89 |
| Predicted disordered residues (%) | 14.75 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151MTX9 | 48-178 | 131 | YCQQLCQTLLEYAEKWKTSEDPLPLLEVYRVAIQSYVKARPYLTSECEKVAFVLERLSLSCVELLLCLPLDLPENKWENFQAFVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5SNS6-F1 | 13-179 | 99.40 | 85.74 | View in AlphaFoldDB ↗ |