DPCfam | MC196567
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 624 ± 46 aa |
| Residues in low-complexity regions (%) | 8.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12047 |
| Sequences matching dominant architecture (%) | 14.04 |
| Average overlap percent | 14.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2GY17 | 27-691 | 665 | AKESSILKPTPRDLPDNDWPCYVLTDATIYQKDGRTLGNPLLVHVQGPLIVRGHLEVDEDKLVPNLVRSSVRTAHIEISHSERYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q5U0-F1 | 3-675 | 99.68 | 69.47 | View in AlphaFoldDB ↗ |