DPCfam | MC196500
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 192 ± 26 aa |
| Residues in low-complexity regions (%) | 9.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 58.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15275 |
| Sequences matching dominant architecture (%) | 80.18 |
| Average overlap percent | 56.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000462CCC0 | 511-707 | 197 | VAAGSSALQPAKKKKVECSYDINNIVIPMSMAAATRVEKLQYKEILTPRWRMVNLEELKSSEEVDSEVEDTSDEAYLNRHHKFEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80TG1-F1 | 791-976 | 94.47 | 52.45 | View in AlphaFoldDB ↗ |