DPCfam | MC196330
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 911 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.56 |
| Predicted disordered residues (%) | 28.4 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01196 |
| Sequences matching dominant architecture (%) | 99.06 |
| Average overlap percent | 85.79 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G0IGQ5 | 1-122 | 122 | MRHRISGRHLGRNINERQSLYRSQLRSLFTNGFINTTDAKAKSILPLAEKIAAAAVRADLNSRRYIFTFFQDRNVVNNIVSAFSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8R7Y3-F1 | 4-112 | 97.32 | 95.37 | View in AlphaFoldDB ↗ |