DPCfam | MC196130
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 691 |
|---|---|
| Mean domain length (aa) | 839 ± 96 aa |
| Residues in low-complexity regions (%) | 5.26 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 20.12 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04738- PF14028 |
| Sequences matching dominant architecture (%) | 73.94 |
| Average overlap percent | 90.64 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q4FUR3 | 22-712 | 691 | LAANDPAKNDLIKESIFLASPELHLAIEKGRSKGLSDKLSSTVRKYTTRMSTRCTPFGIFAASGVGRIEKQTQFNIPTLPEMTAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EVM9-F1 | 50-922 | 97.96 | 92.35 | View in AlphaFoldDB ↗ |