DPCfam | MC196066
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 340 ± 35 aa |
| Residues in low-complexity regions (%) | 5.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.98 |
| Average transmembrane regions | 4.75 |
| Dominant Pfam architecture(s) | PF01564 |
| Sequences matching dominant architecture (%) | 64.58 |
| Average overlap percent | 11.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136JJL7 | 54-394 | 341 | AIVISLLAISANVSRATLSPVYGQIPASIYHDYVVWGCLFLGWSANLAFRRFLPVKTMTLIPVVAWYIPALQTSLFPLSDVLSVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W4Z1-F1 | 66-413 | 99.43 | 95.32 | View in AlphaFoldDB ↗ |