DPCfam | MC19602
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 8.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.35 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03313 |
| Sequences matching dominant architecture (%) | 12.61 |
| Average overlap percent | 1.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6BGL3 | 5-82 | 78 | EEMITLLKNDVVPALGCTEPVCVALCAANAGKMTENKIRSIEVEVNAGIYKNGMSAGIPGCDYVGLPYAAALGAYLKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8A606-F1 | 10-92 | 97.65 | 95.50 | View in AlphaFoldDB ↗ |