DPCfam | MC19600
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02929 |
| Sequences matching dominant architecture (%) | 0.88 |
| Average overlap percent | 41.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W1SSX5 | 821-939 | 119 | YELGRLRSDEPLSVYDDATFLTVPGRYTGLPYVRPEHDDGDSSRRSFLTLTLSSPATVYVAVDTDSSPGWLSGWTDTGDTIGTSD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-T2KN75-F1 | 855-978 | 90.44 | 86.89 | View in AlphaFoldDB ↗ |