DPCfam | MC195959
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 254 ± 40 aa |
| Residues in low-complexity regions (%) | 5.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.36 |
| Average transmembrane regions | 4.51 |
| Dominant Pfam architecture(s) | PF10204 |
| Sequences matching dominant architecture (%) | 86.21 |
| Average overlap percent | 94.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V3ZKE4 | 14-272 | 259 | TFYEPNKTPFKADLVESGLIFCIVILLVSFLAILPGIRGKEKLFTFIRLMVSLYIGSVILLTNFAQTWEVASVHTETKYKAGTGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VJQ7-F1 | 20-280 | 98.49 | 88.60 | View in AlphaFoldDB ↗ |