DPCfam | MC195922
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Residues in low-complexity regions (%) | 4.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 1.74 |
| Average overlap percent | 75.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1N7A5 | 10-80 | 71 | LKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3UHC7-F1 | 127-199 | 96.00 | 69.77 | View in AlphaFoldDB ↗ |