DPCfam | MC195876
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Residues in low-complexity regions (%) | 23.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.77 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094E092D | 101-184 | 84 | TTGGAASNTSIPAGSGANVPGWGIALLVLGALLLGLLLLMLMAMIFWCCCNRGRYNHPDDIPLYTTHSRLWNADSAPAYKDMDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q29435-F1 | 371-465 | 97.92 | 63.16 | View in AlphaFoldDB ↗ |