DPCfam | MC195786
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 305 ± 29 aa |
| Residues in low-complexity regions (%) | 8.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 51.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09382 |
| Sequences matching dominant architecture (%) | 71.11 |
| Average overlap percent | 23.38 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1XGB8 | 1337-1579 | 243 | DGFGQGKSWEKDASTRLVEKLIAEDIICQNYIPNKSGFTNTYIIPGKKQKELSNGRKFEMTFDRSPTAPKKGARIKVSNDQDFES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NCS8-F1 | 1140-1420 | 96.97 | 63.44 | View in AlphaFoldDB ↗ |