DPCfam | MC195735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Residues in low-complexity regions (%) | 14.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.91 |
| Average transmembrane regions | 2.56 |
| Dominant Pfam architecture(s) | PF05307 |
| Sequences matching dominant architecture (%) | 1.0 |
| Average overlap percent | 26.97 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7NPL9 | 24-93 | 70 | VAWLADRGGRRNDSATMRWLAAGIVCIAVLPFGVNYLLEPLVGLSDAATLLAVLVCFNAGLVAILYSLEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O29670-F1 | 10-89 | 97.62 | 96.63 | View in AlphaFoldDB ↗ |