DPCfam | MC195589
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Residues in low-complexity regions (%) | 2.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.71 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07744 |
| Sequences matching dominant architecture (%) | 95.7 |
| Average overlap percent | 92.56 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7RZ29 | 632-806 | 175 | VHRYRSIIWNGLIDLPDIFAFQGHVKQIAGRSLSSTSRVWPKFFPERPLLIAGRLPSKAAVDYLLQVVNAPRTEILAFTMEPGAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8C9B9-F1 | 1050-1193 | 98.60 | 87.97 | View in AlphaFoldDB ↗ |