DPCfam | MC19546
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Residues in low-complexity regions (%) | 0.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2Y2A6 | 650-733 | 84 | YYQLLQVANDMVGAKYSQGGDGRNTWQHQQSGGQGEPYYRNADGFEKAVQMTITLGRGVYLEKWGTLECGLIRSGVTMDDEWKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W179-F1 | 388-473 | 97.73 | 94.48 | View in AlphaFoldDB ↗ |