DPCfam | MC195438
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 423 ± 76 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.08 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02042 |
| Sequences matching dominant architecture (%) | 68.48 |
| Average overlap percent | 6.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A103Y9U4 | 106-440 | 335 | VMEKLIYAIDNIKHYTVDKNVLIQVWLPETRDGKKVLSTSQRLFSLELNCPRLSNYRSISEGYHFPAEGDAKESVGLPGRVFMGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LL19-F1 | 129-610 | 100.00 | 78.64 | View in AlphaFoldDB ↗ |