DPCfam | MC195214
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Residues in low-complexity regions (%) | 6.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02503 |
| Sequences matching dominant architecture (%) | 99.45 |
| Average overlap percent | 40.96 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9E7W4 | 210-276 | 67 | YVLLEDVITHFIHKLFYGYQVTRTFAFRITRNADLTIHEDGAEDLLIEIEKFLKKRKSGAAVRLEID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9EUS8-F1 | 209-288 | 97.56 | 87.57 | View in AlphaFoldDB ↗ |