DPCfam | MC194955
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Residues in low-complexity regions (%) | 22.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.84 |
| Average transmembrane regions | 2.88 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A164J062 | 25-137 | 113 | MAGAGAIAVLLIPWCVWLYYTLPQTVRVGHWPLLWLGLDTAEAISAAVTLLLLLRRSPTAALSAAVGAGLFFADGVFDIGTSLSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FGX5-F1 | 44-152 | 98.20 | 92.48 | View in AlphaFoldDB ↗ |