DPCfam | MC194838
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 610 ± 50 aa |
| Residues in low-complexity regions (%) | 4.88 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 7.77 |
| Average transmembrane regions | 6.86 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003FF7C61 | 49-697 | 649 | FKLFLQRSYYWFGRIVGFKHKRAKVYQQLLIIYGYDERLLREKVSLVLWAIIVVLSGILFVFISFEQDWISLLVLILVLRVADDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DJM1-F1 | 260-399 | 22.70 | 73.78 | View in AlphaFoldDB ↗ |