DPCfam | MC194809
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N8TDW1 | 1-149 | 149 | MLIEIEEQKSIEYVQEWFDFKDGVKLLIASIDKPSFQRSLELNGIQAEQELAGIKAVTDEGAVKAKLGFNRAVSHLLLGWVGLVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P76069-F1 | 3-118 | 79.23 | 90.07 | View in AlphaFoldDB ↗ |