DPCfam | MC194686
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Residues in low-complexity regions (%) | 0.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.97 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00354 |
| Sequences matching dominant architecture (%) | 82.11 |
| Average overlap percent | 36.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3PZ68 | 478-572 | 95 | HLNHRNSNPGTRKKPKSPDAFQIGFPMRTNYMYGRIKKTLLIEIFALTVCLWIKGGSGPGLGTPFSYSVPGQANELVLIEWGNNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6NW91-F1 | 226-302 | 96.15 | 96.97 | View in AlphaFoldDB ↗ |