DPCfam | MC194569
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Residues in low-complexity regions (%) | 0.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9XP72 | 463-543 | 81 | MFLDMDKFFDEFLKVHEFAKAGKTTGLATVGMKMKKKHTIVEKWPTKMKLKLGQLGVKQELKLLRASGLRGDERYVEWKRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GHI5-F1 | 415-502 | 97.78 | 95.02 | View in AlphaFoldDB ↗ |