DPCfam | MC19433
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 701 ± 71 aa |
| Residues in low-complexity regions (%) | 3.17 |
| Residues in coiled-coil regions (%) | 2.25 |
| Predicted disordered residues (%) | 27.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00350 |
| Sequences matching dominant architecture (%) | 88.57 |
| Average overlap percent | 30.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1FW08 | 1-413 | 413 | MLNEQLVRASAVLAVLDYTQLKSISDEEVRQAIMAVGKSVPLYALVNKFDQKDRNSDDEEQVRALISGTLMQGGIAPERIYPVSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZE93-F1 | 28-482 | 63.74 | 83.96 | View in AlphaFoldDB ↗ |